- Recombinant Sinorhizobium medicae Probable intracellular septation protein A (Smed_3090)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1202911
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 23,415 Da
- E Coli or Yeast
- 1-210
- Probable intracellular septation protein A (Smed_3090)
Sequence
MSTVEAAKPKTEVSPLLKLVLELGPLMVFFFANSRGEWLASRFPVLADLGGPIFIATGLFMAATAAALAVSWMMTRTLPMMPLISGIVVFVFGALTLWLQNDTFIKMKPTIVNTLFGAILLGGLLFGKSLLGYVFHAAFKLDEEGWRKLTVRWGVFFLFLAVLNEVIWRSFSTDFWVAFKVWGTMPITILFTLAQMPLIMKHSVDQENAK